FASEB J.
HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


FJ EXPRESS SUMMARY ARTICLE
The
Full-length version of this article is also available, published online July 1, 2004 as doi:10.1096/fj.03-1459fje.
Published as doi: 10.1096/fj.03-1459fje.
This Article
Right arrow Full Text (PDF)
Right arrow All Versions of this Article:
18/12/1407
03-1459fjev1    most recent
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by KERKIS, A.
Right arrow Articles by YAMANE, T.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by KERKIS, A.
Right arrow Articles by YAMANE, T.
(The FASEB Journal. 2004;18:1407-1409.)
© 2004 FASEB

Crotamine is a novel cell-penetrating protein from the venom of rattlesnake Crotalus durissus terrificus

ALEXANDRE KERKIS*,1,2, IRINA KERKIS*,2, GANDHI RÁDIS-BAPTISTA{dagger}, EDUARDO B. OLIVEIRA{ddagger}, ANGELA M. VIANNA-MORGANTE*, LYGIA V. PEREIRA* and TETSUO YAMANE{dagger}

* Departmento de Biologia, Instituto de Biociências, Universidade de São Paulo, São Paulo;
{dagger} Laboratório de Toxinologia Molecular, Instituto Butantan, São Paulo; and
{ddagger} Departmento de Bioquímica e Imunologia, Universidade de São Paulo, Ribeirão Preto, SP, Brasil

1Correspondence: Departamento de Biologia, Instituto de Biociências, Universidade de São Paulo, Rua do Matão, 277, 05508-900, São Paulo, SP, Brasil. E-mail: akerkis{at}usp.br

SPECIFIC AIMS

Peptides rich in basic arginine and lysine residues can be internalized by cells in vitro and in vivo and have been used for intracellular delivery of genes, therapeutic agents, and diagnostic probes. Crotamine, a toxin from the venom of the South American rattlesnake, is a 42 amino acid cationic polypeptide (YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGS—G)containing 11 basic residues (9 lysines, 2 arginines) and 6 cysteines. We evaluated the cytotoxicity of crotamine in murine ES cells. Embryotoxicity was tested in vitro in preimplantation stages (morulae/blastocysts) of the mouse embryo. Uptake of Cy3-conjugated crotamine (Cy3-crotamine) and its intracellular localization were analyzed in different human cells, murine undifferentiated and differentiating ES cells, and in vivo in mouse cells from bone marrow, spleen, and the peritoneal cavity.

PRINCIPAL FINDINGS

1. Nontoxic concentrations of crotamine
Since pluripotency is a conspicuous feature of ES cells that can be lost in altered culture conditions, the effect of 10 and 0.1 µM crotamine on the pluripotency of mouse ES cell line USP-1 was tested during three passages. Alkaline phosphatase was active in undifferentiated cells and its activity was not altered when ES cells were maintained under crotamine treatment. The dynamics of embryoid body (Eb) formation were not impaired, as shown by the number of developed Ebs in experimental and control conditions, as well as by typical rhythmic contractions of the heart muscle observed on developmental day 8. The susceptibility of murine ES and embryonic mouse fibroblasts to crotamine concentrations of 1000–0.01 µM was assayed by clonogenicity. At concentrations of ≤10 µM, crotamine exhibited no toxic effects even after 72 h of exposure, and crotamine-treated cells proliferated for >10 passages. Embryotoxicity of crotamine was investigated by incubating 2.5 day postcoitum compact mouse morulae in the presence of 1 µM crotamine for 24 h. The number of compact morulae developing into blastocysts was similar in control and test groups.

2. In vitro and in vivo uptake of Cy3-crotamine
Cellular uptake of Cy3-crotamine at the nontoxic concentration of 1 µM was monitored by confocal microscopy after 5 min and 1, 3, 24, and 48 h treatment.

In vitro crotamine uptake was observed in human primary fibroblasts, lymphoblastic cells, murine embryonic stem (pluripotent and differentiated), and endothelial s-vec cells. Human fibroblasts were intensively labeled after 1 h of incubation with crotamine (Fig. 1 A); supposedly dividing cells showed stronger signals (Fig. 1B, C ). Pluripotent murine ES cells showed strong fluorescence within islands composed of rounded-up, juxtaposed cells growing onto a feeder layer of inactivated mouse fibroblasts; some islands were weakly labeled (Fig. 1D, E ). A weak background of fluorescent signals was seen in control ES cultures stained by Cy3 dye (Fig. 1F ).



View larger version (106K):
[in this window]
[in a new window]
 
Figure 1. In vitro and in vivo uptake of Cy3-crotamine in different cell types. A) In vitro crotamine uptake after 1 h treatment in human fibroblasts; inset: rounded-up, supposedly dividing cells (Fcm, fluorescent confocal microscopy; bar=100 µm). B, C) Higher magnification of inset in panel A: dividing cells (asterisk) are strongly labeled with crotamine; a weak signal is observed in quiescent cells (arrowhead) (B, Fcm; C, Dic, digital interference contrast; bars=25 µm). D, E) Pluripotent ES cells with strong (asterisk) and weak crotamine labeling (arrowhead) observed within the islands (D, Fcm; E, Dic; bars=100 µm). F) Control cultured ES cells treated with Cy3 dye for 3 h, showing a weak background fluorescence (overlay of Dic+Fcm; bar=100 µm). G–I) In vivo crotamine uptake observed 3 h after injection into mice: peritoneal liquid cells show strong fluorescence in the perinuclear space and in the nuclei (G, Fcm, H, Dic, I, Dic+Fcm; bars=100 µm).

In vivo uptake of crotamine was studied by i.p. injection of Cy3-crotamine into CD-1 mice. Strong fluorescence was observed in peritoneal liquid cells (Fig. 1G-I ) and bone marrow cells; only weak background fluorescence was seen in control Cy3-injected mice.

The cells internalize crotamine within 5 min after its addition. The number of labeled cells did not appear to increase with longer exposure times, reaching a maximum after ~3 h of treatment. Cell labeling was no longer detected 16–24 h after removal of fluorescent crotamine from the culture medium. Parallel experiments demonstrated that Cy3-conjugated crotamine was efficiently internalized at concentrations as low as 10 nM at 37°C but not at 4°C.

3. Nuclear localization of crotamine
Cy3-crotamine was visualized in the nuclear and perinuclear regions in different cell types from bone marrow and peritoneal liquid cells (Fig. 1G-I , Fig. 2 A–C; G–S). DNA DAPI staining partially overlapped crotamine localization in the nuclei.



View larger version (51K):
[in this window]
[in a new window]
 
Figure 2. Cy3-crotamine as a marker of centrioles in living cells. A) Peritoneal liquid cells showing Cy3-crotamine fluorescence on centrosomes (arrowheads). Dic + Fcm; bar = 100 µm. B) Microtubules and esters (arrowheads) immunolabeled by anti-{alpha}-tubulin (green) in pluripotent ES cell. C) Superimposed images of centrioles labeled with Cy3-crotamine (red) and esters immunolabeled by anti-{alpha}-tubulin (green): yellow labeling of the centrioles results from the superposition of red and green labels). Chromosomes are strongly labeled (red) by crotamine (B, C, Fcm; bars=10 µm). D–S) Centriole labeling (arrowheads) by Cy3-crotamine in peritoneal liquid cells. D–F) In G1 phase, pericentriolar material associated with a pair of centrioles is strongly labeled by crotamine. G–I) In S/G2 phase the duplicated centrioles start separation. Fluorescence is observed in the cell nucleus. J–L) In prophase, the two centrioles are moving to opposite poles. Crotamine binding to chromosomes becomes evident. In metaphase(M–O) and anaphase (P–S) strong fluorescence is observed on centrioles and on chromosomes. D, G, J, M, P, Fcm; E, H, K, N, R, Dic; F, I, L, O, S, Dic + FCM; bars = 10 µm.

Injection of unlabeled crotamine was followed by injection of Cy3-crotamine; after another 15 min fluorescence was seen to be restricted to the cytoplasm, preferential to the perinuclear space, indicating a saturation of binding sites by unlabeled crotamine within the nucleus. The same results were observed in human fibroblast by treating cells with unlabeled and Cy3-crotamine.

4. Crotamine as a marker of centrioles and during the cell cycle
Cy3-crotamine also seems to function as a marker of the centrosome cycle. Figure 2A shows centrioles from peritoneal liquid cells labeled with Cy3-crotamine at different phases of the cell cycle. Anti-{alpha}-tubulin antibody was used in ES cells to highlight the spindle and esters, small star-like structures formed by new microtubules growing out from centrosomes during mitosis (Fig. 2B ). Cy3-crotamine colocalizes with esters immunostained by anti-tubulin, indicating its centrosome association (Fig. 2C ). Cy3-crotamine labels the chromosomes attached to the {alpha}-tubulin immunostained spindle (Fig. 2C ).

Centrosome duplication and separation were observed in Cy3-crotamine-treated peritoneal liquid cells (Fig. 2D-S ). Centrioles and the associated centrosome matrix were initially observed as a single complex (Fig. 2D-F ). In S/G2, two centrioles could be seen as they began to move apart (Fig. 2G-L ). At metaphase (Fig. 2M-O ) and anaphase (Fig. 2P-S ), the centrioles were observed in opposite poles. In S/G2 phase, the fluorescent signal appeared on the chromosomes (Fig. 2G-I ) and became very strong at metaphase (Fig. 2M-O ).

5. Crotamine as a marker of actively proliferating cells
Cy3-crotamine cell labeling varied in intensity (Fig. 1A-E ). This was striking when ES cells were induced to differentiate through Ebs: a 6 day monolayer culture of a differentiating Eb was treated with Cy3-crotamine for 24 h, and undifferentiated ES cells within the Eb, which supposedly were actively proliferating, appeared strongly labeled.

A 5-BrdU proliferation assay was used to investigate whether crotamine preferentially labels actively proliferating cells in differentiating Ebs. 5-BrdU incorporation into DNA during replication was monitored by anti-BrdU antibody immunostaining. Cy3-crotamine was added with 5-BrdU into cultures of differentiating Ebs. While an intensive crotamine labeling was observed in the areas of actively proliferating ES cells, a weak Cy3-fluorescence was seen in areas of predominantly nondividing cells. Crotamine and 5-BrdU had nuclear localization in the actively proliferating cells, but overlapping was not complete, indicating different sites of interaction of crotamine and 5-BrdU.

CONCLUSION AND SIGNIFICANCE

ES cells were used to study the toxicity of crotamine, a toxin from rattlesnake venom. Crotamine in micromolar concentrations had no toxic effect on ES cells in vitro. We demonstrated it did not inhibit Ebs formation or ES cell differentiation into contracting myocardium and was nontoxic for developing mouse blastocysts.

We investigated crotamine internalization in vitro in different cell lines and in vivo in cell types isolated from mouse. Internalization was always effective and cells showed strong labeling within 5 min of treatment with Cy3-crotamine, a feature shared with other cell-penetrating proteins. Signals of similar intensity were observed in cells incubated with 1 µM Cy3-crotamine for 1–48 h. Cells incubated with Cy3-crotamine at concentrations as low as 10 nM were rapidly and intensively labeled.

Once internalized, Cy3-crotamine was observed in the perinuclear space and cell nucleus. Its nuclear localization was confirmed by DAPI staining and a peptide competition assay demonstrating that Cy3-crotamine was not translocated into the nucleus when binding sites had been saturated by unlabeled crotamine. Since fixation is known to produce artificial nuclear localization of cationic peptides, crotamine penetration into the nuclei was studied in unfixed and fixed cells; its nuclear localization was observed in both cases.

Crotamine was shown to bind to DAPI-stained and 5-BrdU-labeled metaphase chromosomes. It seems to bind to chromosomes in S/G2 and G2/M phases, when fluorescent labeling becomes evident on all chromosomes. At the end of telophase, crotamine is restricted to the cytoplasm. After 16–24 h of its removal from cell culture medium, crotamine is not detected in cells. Crotamine differs in this regard from herpes simplex VP22 protein, which binds to chromatin after internalization and segregates to daughter cells.

Crotamine was demonstrated to specifically associate with centrosomes by simultaneous anti-tubulin immunostaining and crotamine labeling of esters, allowing the position of the cell in the cell cycle to be assigned. As a centriolar marker, it appears to be a tool to monitor unfixed human tumor cells characterized by an abnormally high number of centrosomes. Crotamine was shown to selectively label actively proliferating living cells both in vivo and in vitro (Fig. 3 ).



View larger version (24K):
[in this window]
[in a new window]
 
Figure 3. Uptake of crotamine into actively proliferating cells. Crotamine (red) penetrates the cells within 5 min. G1 phase: it localizes in the cytoplasm and associates with the centrosomes. S/G2 phase: crotamine predominantly localizes in the perinuclear region and appears in the nucleus (blue). Prophase: in early prophase, crotamine strongly associates with separating centrosomes and afterwards it appears on the condensed chromatin. Metaphase: crotamine labels well-defined chromosomes throughout their length, and shows centrosome association. Cytokinesis: crotamine localizes in the cytoplasm. It is not detectable in the cells 16–24 h after its removal from the culture medium.

Crotamine was characterized as a cell-penetrating protein with nuclear localization in vitro and in vivo. The nature of crotamine interaction with chromatin is unclear, but our morphological data indicate that the mechanisms involved differ from those of DAPI or 5-BrdU.

FOOTNOTES

2 These authors contributed equally to this work.

To read the full text of this article, go to http://www.fasebj.org/cgi/doi/10.1096/fj.03-1459fje; doi: 10.1096/fj.03-1459fje




This article has been cited by other articles:


Home page
J. Biol. Chem.Home page
F. D. Nascimento, M. A. F. Hayashi, A. Kerkis, V. Oliveira, E. B. Oliveira, G. Radis-Baptista, H. B. Nader, T. Yamane, I. L. dos Santos Tersariol, and I. Kerkis
Crotamine Mediates Gene Delivery into Cells through the Binding to Heparan Sulfate Proteoglycans
J. Biol. Chem., July 20, 2007; 282(29): 21349 - 21360.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Full Text (PDF)
Right arrow All Versions of this Article:
18/12/1407
03-1459fjev1    most recent
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by KERKIS, A.
Right arrow Articles by YAMANE, T.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by KERKIS, A.
Right arrow Articles by YAMANE, T.


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS